Product Details
Place of Origin: China
Brand Name: Hongbaiyi
Certification: COA, HLPC
Model Number: HBY-Teriparatide
Document: Product Brochure PDF
Payment & Shipping Terms
Minimum Order Quantity: 5 boxes
Price: Negotiable
Packaging Details: 5/10/15mg/vial, 10vials/Box
Delivery Time: 3~5 days, upon recepient of payment
Payment Terms: T/T, Western Union,
Supply Ability: 5000 boxes per month
Product Name: |
Teriparatide |
Synonyms: |
PTH (1-34), Human Parathyroid Hormone Fragment 1-34, Forteo |
CAS Number: |
52232-67-4 |
Molecular Formula: |
C181H291N55O51S2 |
Molecular Weight: |
4117.72 G/mol |
Sequence Length: |
34 Amino Acids |
Sequence: |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Peptide Type: |
Recombinant PTH Analog / PTH1 Receptor Agonist |
Purity: |
≥99% (HPLC) |
Product Name: |
Teriparatide |
Synonyms: |
PTH (1-34), Human Parathyroid Hormone Fragment 1-34, Forteo |
CAS Number: |
52232-67-4 |
Molecular Formula: |
C181H291N55O51S2 |
Molecular Weight: |
4117.72 G/mol |
Sequence Length: |
34 Amino Acids |
Sequence: |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Peptide Type: |
Recombinant PTH Analog / PTH1 Receptor Agonist |
Purity: |
≥99% (HPLC) |
Teriparatide (PTH 1-34) – High-Purity Research Peptide
Teriparatide is a recombinant peptide consisting of the first 34 amino acids of human parathyroid hormone (PTH 1-34). It is a potent PTH1 receptor agonist that stimulates osteoblast activity and promotes bone formation, making it a widely used tool in bone metabolism and osteoporosis-related research.
Unlike antiresorptive agents, Teriparatide acts as an anabolic agent, increasing bone mineral density through intermittent activation of the PTH1 receptor and subsequent elevation of cAMP/PKA signaling pathways.
