Product Details
Place of Origin: China
Brand Name: HBY
Certification: COA, HPLC
Model Number: HBY-Mazdutide
Document: Product Brochure PDF
Payment & Shipping Terms
Minimum Order Quantity: 5 boxes
Price: Negotiable
Packaging Details: 5/10/15mg/vial, 10vials/Box
Delivery Time: 3~5 days, upon recepient of payment
Payment Terms: T/T, Western Union, etc.
Supply Ability: 5000 boxes per month
Product Name: |
Mazdutide |
CAS Number: |
2259884-03-0 |
Molecular Formula: |
C₂₁₀H₃₂₂N₄₆O₆₇ |
Molecular Weight: |
≈ 4563 Da |
Purity: |
≥98% / ≥99% (HPLC) |
Appearance: |
White To Off-white Lyophilized Powder |
Sequence: |
HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG |
Product Name: |
Mazdutide |
CAS Number: |
2259884-03-0 |
Molecular Formula: |
C₂₁₀H₃₂₂N₄₆O₆₇ |
Molecular Weight: |
≈ 4563 Da |
Purity: |
≥98% / ≥99% (HPLC) |
Appearance: |
White To Off-white Lyophilized Powder |
Sequence: |
HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG |
